Pay in 4 interest-free payments of $31.15 Learn more
Ships within 48 hours · Estimated delivery Aug 1 - Aug 6
also designated DIABLO in mouse for direct IAP binding protein with low PI) promotes caspase activation in the cytochrome c/Apaf-1/caspase-9 pathway by binding IAPs and preventing them from inhibiting caspases
Phosphorylation of H2B serine 32 occurs in normal cycling and mitogen-stimulated cells
MB11028-100
AA Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKN
cerevisiae based on its ability to de-repress transcriptional silencing when overexpressed
Recombinant Human BMPRIA/ALK-3 Protein (Fc & His Tag) - PKSH032120 HeLa Transfection also designated DIABLO in mouseRecombinant Human BMPRIA ALK 3 Protein (Fc & His Tag) Size: 50g Catalogue Numbers: PKSH032120 50 Citations, Manuals and MSDS Available upon request. Abbreviation: BMPRIA; ALK 3 Target Synonym: Bone Morphogenetic Protein Receptor Type 1A; BMP Type 1A Receptor; BMPR 1A; Activin Receptor Like Kinase 3; ALK 3; Serine Threonine Protein Kinase Receptor R5; SKR5; CD292; BMPR1A; ACVRLK3; ALK3; 10q23del UNIProt ID: P36894 Research Areas: Signal Transduction;